PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G17340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 224aa    MW: 24629.7 Da    PI: 5.9371
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G17340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.1e-1068116250
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      ++l ++rr   NReA r++R++Kka  + Lee+vk+L a N++L  +l+
  LPERR05G17340.1  68 EDLTKARRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQ 116
                      67899***************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.7E-1567135No hitNo description
SMARTSM003381.5E-1167134IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9969116IPR004827Basic-leucine zipper domain
PfamPF077162.7E-1369124IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-872117No hitNo description
CDDcd146861.08E-1372125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDDVPSQLLF SHPELPDSFD DFMNNITTCT HTHTCNPPGP SATTHTHTCL HTHTQVFATG  60
SGEEDIKEDL TKARRPLGNR EAVRKYREKK KAHAAFLEEE VKKLRAANQQ LLRRLQGHAA  120
LEAEVIRLRS ILFDVRGKID MEIGTFPFQK PCSVGSVACT DPSMCFNGNS ETGGVWEECS  180
RPVGADHMID KDGSMSQEID IPGPVHSISM DVVGSLVTSA SLSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1121600.0AC112160.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1579_G03, complete sequence.
GenBankAK0722810.0AK072281.1 Oryza sativa Japonica Group cDNA clone:J023018E07, full insert sequence.
GenBankAK1049860.0AK104986.1 Oryza sativa Japonica Group cDNA clone:002-110-E11, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638714.11e-141PREDICTED: uncharacterized protein LOC4339196
SwissprotQ8GTS21e-55BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D9WI591e-168A0A0D9WI59_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g41540.11e-141(Oryza sativa Japonica Group)
STRINGORGLA05G0186200.11e-141(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-29bZIP family protein